PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG361200.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 321aa    MW: 34977.2 Da    PI: 6.5094
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG361200.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61.1e-18155209256
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          rk+ +++keq   Le+ F+ +++++ +++ +LAk+l+L  rqV vWFqNrRa+ k
  Pavir.1KG361200.4.p 155 RKKLRLSKEQSALLEDSFKGHSTLTPKQKSDLAKQLKLRPRQVEVWFQNRRARTK 209
                          678899***********************************************98 PP

2HD-ZIP_I/II125.52.4e-40155244191
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          +kk+rlskeq++lLE+sF+ +++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr+++al++en+rL++ev+eLr +
  Pavir.1KG361200.4.p 155 RKKLRLSKEQSALLEDSFKGHSTLTPKQKSDLAKQLKLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCEALAQENRRLHREVAELR-A 243
                          69*************************************************************************************9.5 PP

          HD-ZIP_I/II  91 l 91 
                          l
  Pavir.1KG361200.4.p 244 L 244
                          5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-17135209IPR009057Homeodomain-like
SuperFamilySSF466896.42E-18151220IPR009057Homeodomain-like
PROSITE profilePS5007117.119151211IPR001356Homeobox domain
SMARTSM003892.4E-15153215IPR001356Homeobox domain
PfamPF000466.3E-16155209IPR001356Homeobox domain
CDDcd000864.50E-16155212No hitNo description
PROSITE patternPS000270186209IPR017970Homeobox, conserved site
SMARTSM003401.1E-22211254IPR003106Leucine zipper, homeobox-associated
PfamPF021831.3E-11211244IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MELELSLGDS PALAKCTSTP MLTPTYAGKE DHELVLELGV GTAKRTEQDN QKTPKQPGED  60
AQDQEDDGEA CFRSESPVEL SLGCPLLPAS AETGSANSEE CRRGFEVNTV VVDGESAQGR  120
SLSTSSLPRE VSVRQAADQE AAEDEENSGV GRGVRKKLRL SKEQSALLED SFKGHSTLTP  180
KQKSDLAKQL KLRPRQVEVW FQNRRARTKL KQTEVDCEYL KRCCEALAQE NRRLHREVAE  240
LRALRTAPYP FYGHLPAAGF STACVCPSCD DKVIAAHHSS ITATSLAVPP PSPVSTLFAR  300
PHFGPFTIHP VLRRQPSATS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203211RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952725.10.0PREDICTED: homeobox-leucine zipper protein HOX7-like
SwissprotA2X6741e-105HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
TrEMBLK3YZM61e-179K3YZM6_SETIT; Uncharacterized protein
STRINGSi019736m1e-178(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.16e-56homeobox from Arabidopsis thaliana